Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HAI-2/SPINT2 Antibody (1) [mFluor Violet 610 SE]
NBP2-90373MFV610 0.1 mL

Rabbit Monoclonal HAI-2/SPINT2 Antibody (1) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TMED4 (NM_001303061) Human Tagged ORF Clone
RG236228 10 µg

TMED4 (NM_001303061) Human Tagged ORF Clone

Sign In for Pricing
View Details
Acetic Acid 99.85% ACS Food Grade
GPC8005-E 1 L

Acetic Acid 99.85% ACS Food Grade

Sign In for Pricing
View Details
TNFSF9 protein (His tag)
MBS5303709-01 0.1 mg

TNFSF9 protein (His tag)

Sign In for Pricing
View Details
TNFSF9 protein (His tag)
MBS5303709-02 5x 0.1 mg

TNFSF9 protein (His tag)

Sign In for Pricing
View Details
SNAP 94847 25mg
A19925-25 25 mg

SNAP 94847 25mg

Sign In for Pricing
View Details