Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL33 (NM_001109997) Human Tagged ORF Clone
RC225752 10 µg

KLHL33 (NM_001109997) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Tryptophan-2,3-dioxygenase (TDO) ELISA Kit
YP-W20595-01 48 Tests

Mouse Tryptophan-2,3-dioxygenase (TDO) ELISA Kit

Sign In for Pricing
View Details
Mouse Tryptophan-2,3-dioxygenase (TDO) ELISA Kit
YP-W20595-02 96 Tests

Mouse Tryptophan-2,3-dioxygenase (TDO) ELISA Kit

Sign In for Pricing
View Details
DEPDC1A siRNA (Mouse)
CRM9580-01 15 nmol

DEPDC1A siRNA (Mouse)

Sign In for Pricing
View Details
DEPDC1A siRNA (Mouse)
CRM9580-02 30 nmol

DEPDC1A siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) narL Polyclonal antibody
MBS7163967-01 0.05 mL

Rabbit anti-Escherichia coli (strain K12) narL Polyclonal antibody

Sign In for Pricing
View Details