Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (029) [mFluor Violet 450 SE]
NBP2-89249MFV450 0.1 mL

Rabbit Monoclonal Bone marrow stromal cell antigen 1/CD157 Antibody (029) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
P311 CRISPR Activation Plasmid (h2)
sc-418011-ACT-2 20 µg

P311 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Ogt (NM_139144) Mouse Tagged Lenti ORF Clone
MR211521L1 10 µg

Ogt (NM_139144) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Scaffold attachment factor B2 (SAFB2) (NM_014649) Human Tagged ORF Clone Lentiviral Particle
RC221384L4V 200 µL

Scaffold attachment factor B2 (SAFB2) (NM_014649) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Eif3e activation kit by CRISPRa
GA202178 1 Kit

Mouse Eif3e activation kit by CRISPRa

Sign In for Pricing
View Details
3,5-Di-tert-butyl-2-hydroxybenzaldehyde 98+% (HPLC)
232277-01 5 g

3,5-Di-tert-butyl-2-hydroxybenzaldehyde 98+% (HPLC)

Sign In for Pricing
View Details