Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal P-Selectin/CD62P Antibody (03) [DyLight 594]
NBP3-30734DL594 0.1 mL

Mouse Monoclonal P-Selectin/CD62P Antibody (03) [DyLight 594]

Sign In for Pricing
View Details
RGD1559502 Protein Vector (Rat) (pPM-C-His)
PV300145 500 ng

RGD1559502 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
DFF45 (Cleaved-Ser118) Antibody
L0482-01 50 μL

DFF45 (Cleaved-Ser118) Antibody

Sign In for Pricing
View Details
DFF45 (Cleaved-Ser118) Antibody
L0482-02 100 µL

DFF45 (Cleaved-Ser118) Antibody

Sign In for Pricing
View Details
TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3)
MBS641352-01 0.1 mg

TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3)

Sign In for Pricing
View Details
TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3)
MBS641352-02 5x 0.1 mg

TXNDC9 (Thioredoxin Domain-containing Protein 9, ATP-binding Protein Associated with Cell Differentiation, APACD, Protein 1-4, PHLP3)

Sign In for Pricing
View Details