Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRBP1 (NM_001042576) Human Tagged ORF Clone Lentiviral Particle
RC218816L2V 200 µL

RRBP1 (NM_001042576) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Triap1 (NM_026933) AAV Particle
MR200110A1V 250 µL

Mouse Triap1 (NM_026933) AAV Particle

Sign In for Pricing
View Details
NADK Human Gene Knockout Kit (CRISPR)
KN400544 1 Kit

NADK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AK8 polyclonal antibody
BS75448-01 50 µL

AK8 polyclonal antibody

Sign In for Pricing
View Details
AK8 polyclonal antibody
BS75448-02 100 µL

AK8 polyclonal antibody

Sign In for Pricing
View Details
Mouse mmu-miR-8120 miRNA Agomir
abx884484-01 5 nmol

Mouse mmu-miR-8120 miRNA Agomir

Sign In for Pricing
View Details