Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRR1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2779708 1.0 µg DNA

LRR1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Hydrocarbon Mixture, 7 components, 2000ug/ml each in Methanol
F263323 1 mL

Hydrocarbon Mixture, 7 components, 2000ug/ml each in Methanol

Sign In for Pricing
View Details
Spn 3'UTR Lenti-reporter-Luc Vector
45350084 1.0 µg

Spn 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GRHPR mouse monoclonal antibody
MB4235 25 ul

GRHPR mouse monoclonal antibody

Sign In for Pricing
View Details
CTHRC1 Protein, Human, Recombinant (His & Avi), Biotinylated
MF-0137180-01 5 µg

CTHRC1 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details
CTHRC1 Protein, Human, Recombinant (His & Avi), Biotinylated
MF-0137180-02 10 µg

CTHRC1 Protein, Human, Recombinant (His & Avi), Biotinylated

Sign In for Pricing
View Details