Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPA ORF Vector (Human) (pORF)
ORF000699 1.0 µg DNA

ASPA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
ELK10191-01 48 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
ELK10191-02 96 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
ELK10191-03 5x 96 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
CCNA2 Rabbit Polyclonal Antibody
ES10506-01 50 µL

CCNA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNA2 Rabbit Polyclonal Antibody
ES10506-02 100 µL

CCNA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details