Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: LBI2G2]
AMM12782V 100 µL

PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: LBI2G2]

Sign In for Pricing
View Details
P-eIF2A (S51) Antibody, mAb, Rabbit
A02446-50 50 µL

P-eIF2A (S51) Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mouse L1cam Pre-designed siRNA Set B
SI107384B 1 Each

Mouse L1cam Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human SULT1B1 Pre-designed siRNA Set A
SI016034A 1 Each

Human SULT1B1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NHS-SS-PEG-Cholesterol (2 kDa)
VCar-Ly124 25 mg

NHS-SS-PEG-Cholesterol (2 kDa)

Sign In for Pricing
View Details
SYJ2B rabbit pAb
RA30184-01 50 µL

SYJ2B rabbit pAb

Sign In for Pricing
View Details