Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SIX6 Antibody [DyLight 594]
NBP2-98116DL594 0.1 mL

Rabbit Polyclonal SIX6 Antibody [DyLight 594]

Sign In for Pricing
View Details
Neurod4 (NM_001105942) Rat Tagged Lenti ORF Clone
RR211380L4 10 µg

Neurod4 (NM_001105942) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Meta-Phosphoric Acid 56-60% For Synthesis
02010 00500 500 g

Meta-Phosphoric Acid 56-60% For Synthesis

Sign In for Pricing
View Details
Rabbit Polyclonal ADAM20 Antibody [Janelia Fluor 549]
NBP2-98032JF549 0.1 mL

Rabbit Polyclonal ADAM20 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Porcine concanavalin A (ConA) ELISA Kit
MBS2612747-01 48 Well

Porcine concanavalin A (ConA) ELISA Kit

Sign In for Pricing
View Details
Porcine concanavalin A (ConA) ELISA Kit
MBS2612747-02 96 Well

Porcine concanavalin A (ConA) ELISA Kit

Sign In for Pricing
View Details