Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ip6k2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4104802 1.0 µg DNA

Ip6k2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Soga1 (NM_001164663) Mouse Untagged Clone
MC224795 10 µg

Soga1 (NM_001164663) Mouse Untagged Clone

Sign In for Pricing
View Details
DGKH (NM_178009) Human Over-expression Lysate
LS160851-100ug 100 µg

DGKH (NM_178009) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human RTP2 shRNA (UAS) - Lentiviral human RTP2 shRNA (UAS, RFP) (25)
GTR15079523 1 Vial

Lentiviral human RTP2 shRNA (UAS) - Lentiviral human RTP2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human CYP19A1 sgRNA gene knockout kit - Lentiviral human CYP19A1 sgRNA gene knockout kit (100)
GTR15379621 1 Vial

Lentiviral human CYP19A1 sgRNA gene knockout kit - Lentiviral human CYP19A1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
CCL7 siRNA (Rat)
CRR3906-01 15 nmol

CCL7 siRNA (Rat)

Sign In for Pricing
View Details