TSLP, Mouse (HEK293, Fc)
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html
Purity
98.0
Smiles
YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
Molecular Formula
53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)
Molecular Weight
Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) APC
PDGFD (Platelet-derived Growth Factor D, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, IEGF, SCDGFB, MSTP036, UNQ1899/PRO4345, MGC26867) APC