Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr633 Double Nickase Plasmid (m)
sc-434506-NIC 20 µg

Olfr633 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SLC35F3 AAV Vector (Human) (CMV)
44149101 1 µg

SLC35F3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Brucella Abortus engB Protein (aa 1-241)
VAng-Lsx4850-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus engB Protein (aa 1-241)

Sign In for Pricing
View Details
OVCH1, NT (OVCH1, Ovochymase-1) (FITC)
MBS6329969-01 0.2 mL

OVCH1, NT (OVCH1, Ovochymase-1) (FITC)

Sign In for Pricing
View Details
OVCH1, NT (OVCH1, Ovochymase-1) (FITC)
MBS6329969-02 5x 0.2 mL

OVCH1, NT (OVCH1, Ovochymase-1) (FITC)

Sign In for Pricing
View Details
Mouse CD248 Antibody , PE
E55A10788 50 Tests

Mouse CD248 Antibody , PE

Sign In for Pricing
View Details