Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Adiantum capillus-veneris Photosystem I assembly protein Ycf4 (ycf4), partial
MBS7091800 Inquire

Recombinant Adiantum capillus-veneris Photosystem I assembly protein Ycf4 (ycf4), partial

Sign In for Pricing
View Details
Recombinant Escherichia coli trxC Protein (aa 1-139)
VAng-Lsx02674-500gEcoli 500 µg (E. coli)

Recombinant Escherichia coli trxC Protein (aa 1-139)

Sign In for Pricing
View Details
ACTGP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0036006 1.0 µg DNA

ACTGP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-SMC1 (S957)
329292-01 50 µg

Phospho-SMC1 (S957)

Sign In for Pricing
View Details
Phospho-SMC1 (S957)
329292-02 100 µg

Phospho-SMC1 (S957)

Sign In for Pricing
View Details
Bile Acid Receptor (NR1H4) (NM_005123) Human Tagged ORF Clone Lentiviral Particle
RC217443L4V 200 µL

Bile Acid Receptor (NR1H4) (NM_005123) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details