TSLP, Mouse (HEK293, Fc)
TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html
Purity
98.0
Smiles
YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE
Molecular Formula
53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)
Molecular Weight
Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
CD9 (BA2, DRAP27, Leukocyte antigen MIC3, MIC3, Motility related protein, MRP1, P24, Tetraspanin 29, Tspan29) (AP) discontinued
Biotin-Linked Anti-Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
Biotin-Linked Anti-Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
Biotin-Linked Anti-Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES)
