Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Mouse (HEK293, Fc)

TSLP protein, as a cytokine, plays a key role in immune regulation. It induces monocytes to release T-cell attracting chemokines and significantly promotes the maturation of CD11c (+) dendritic cells. TSLP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TSLP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQSPE

Molecular Formula

53603 (Gene_ID) Q9JIE6 (Y20-E140) (Accession)

Molecular Weight

Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-31 ELISA Kit, 2 x 96-well (pre-coated)
EA101850 2x 96 Well (Pre-Coated)

Human IL-31 ELISA Kit, 2 x 96-well (pre-coated)

Sign In for Pricing
View Details
Laurotetanine
MF-0151374 25 mg

Laurotetanine

Sign In for Pricing
View Details
TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (Biotin) discontinued
043402-Biotin 200 µL

TSSK6, NT (TSSK6, SSTK, Testis-specific serine/threonine-protein kinase 6, Cancer/testis antigen 72, Serine/threonine-protein kinase SSTK, Small serine/threonine kinase) (Biotin) discontinued

Sign In for Pricing
View Details
SW948 cell line
CL-0629 1x 10^6 Cells/Vial

SW948 cell line

Sign In for Pricing
View Details
Hils1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3739706 1.0 µg DNA

Hils1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Gldc ORF Vector (Rat) (pORF)
ORF067586 1.0 µg DNA

Gldc ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details