Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lingo2 Rabbit Polyclonal Antibody (HRP)

Lingo2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LE, Lr, Lern3, Lrrn6c, B230217C06Rik

UniProt

Q3URE9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Lingo2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdx1 (Pdx Family Homeodomain Transcription Factor) Control Peptide
MBS658359-01 1 mg

Pdx1 (Pdx Family Homeodomain Transcription Factor) Control Peptide

Sign In for Pricing
View Details
Pdx1 (Pdx Family Homeodomain Transcription Factor) Control Peptide
MBS658359-02 5x 1 mg

Pdx1 (Pdx Family Homeodomain Transcription Factor) Control Peptide

Sign In for Pricing
View Details
Human NAT8B Pre-designed siRNA Set B
SI010266B 1 Each

Human NAT8B Pre-designed siRNA Set B

Sign In for Pricing
View Details
2- (4'-bromobiphenyl-4-yl) benzo[b]thiophene
JH918830 1 Each

2- (4'-bromobiphenyl-4-yl) benzo[b]thiophene

Sign In for Pricing
View Details
Recombinant Human MTA3 Protein, N-His
MBS1587655-01 0.1 mg

Recombinant Human MTA3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MTA3 Protein, N-His
MBS1587655-02 1 mg

Recombinant Human MTA3 Protein, N-His

Sign In for Pricing
View Details