Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LINGO2 Rabbit Polyclonal Antibody (HRP)

LINGO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LERN3, LRRN6C

UniProt

Q7L985

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LINGO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILDLSKNRLKSVNPEEFISYPLLEEIDLSDNIIANVEPGAFNNLFNLRSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His
orb3060019-01 50 µg

Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His
orb3060019-02 100 µg

Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His
orb3060019-03 1 mg

Recombinant ASFV Polyprotein pp62/Ba71V-94/ASFV-p15 Protein, N-His

Sign In for Pricing
View Details
PEX6 (PXAAA1, Peroxisome Assembly Factor 2, PAF-2, Peroxisomal-type ATPase 1, Peroxisomal Biogenesis Factor 6, Peroxin 6)
131176 100 µg

PEX6 (PXAAA1, Peroxisome Assembly Factor 2, PAF-2, Peroxisomal-type ATPase 1, Peroxisomal Biogenesis Factor 6, Peroxin 6)

Sign In for Pricing
View Details
TESK2 (Dual Specificity Testis-specific Protein Kinase 2, Testicular Protein Kinase 2) (MaxLight 490)
MBS6203705-01 0.1 mL

TESK2 (Dual Specificity Testis-specific Protein Kinase 2, Testicular Protein Kinase 2) (MaxLight 490)

Sign In for Pricing
View Details
TESK2 (Dual Specificity Testis-specific Protein Kinase 2, Testicular Protein Kinase 2) (MaxLight 490)
MBS6203705-02 5x 0.1 mL

TESK2 (Dual Specificity Testis-specific Protein Kinase 2, Testicular Protein Kinase 2) (MaxLight 490)

Sign In for Pricing
View Details