Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPK Rabbit Polyclonal Antibody (HRP)

LIPK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LIPL2, bA186O14.2

UniProt

Q5VXJ0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LIPK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIY

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001073987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1 (NM_001135729) Human Tagged ORF Clone Lentiviral Particle
RC227126L4V 200 µL

TOM1 (NM_001135729) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)
MBS6012589-01 0.2 mL

C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)

Sign In for Pricing
View Details
C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)
MBS6012589-02 5x 0.2 mL

C19orf39, ID (SWSAP1, C19orf39, ATPase SWSAP1, SWIM-type zinc finger 7-associated protein 1, SWS1-associated protein 1, ZSWIM7-associated protein 1)

Sign In for Pricing
View Details
2- ((4-methylphenyl) sulfonyl) -3- (4-phenylpiperazinyl) prop-2-enenitrile
KKB18630 250 mg

2- ((4-methylphenyl) sulfonyl) -3- (4-phenylpiperazinyl) prop-2-enenitrile

Sign In for Pricing
View Details
Gnb4 Mouse shRNA Lentiviral Particle (Locus ID 14696)
TL510680V 500 µL Each

Gnb4 Mouse shRNA Lentiviral Particle (Locus ID 14696)

Sign In for Pricing
View Details
Dnase2b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3780102 1.0 µg DNA

Dnase2b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details