Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM5 Rabbit Polyclonal Antibody (Biotin)

LSM5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

YER146W

UniProt

Q9Y4Y9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LSM5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036454

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9)
T8181-11C 100 µg

DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9)

Sign In for Pricing
View Details
Bovine Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) ELISA Kit
AE26369BO-01 48 Tests

Bovine Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) ELISA Kit

Sign In for Pricing
View Details
Bovine Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) ELISA Kit
AE26369BO-02 96 Tests

Bovine Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) ELISA Kit

Sign In for Pricing
View Details
TBR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
46295066 1.0 µg DNA

TBR1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RAD1 AAV Vector (Mouse) (CMV)
38406104 1 µg

RAD1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Anti-Phospho-BRCA1 (Ser988) Polyclonal Antibody
TMAC-00471-01 50 μL

Anti-Phospho-BRCA1 (Ser988) Polyclonal Antibody

Sign In for Pricing
View Details