Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS16 Rabbit Polyclonal Antibody (Biotin)

MRPS16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COXPD2, RPMS16, CGI-132, MRP-S16

UniProt

Q9Y3D3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_057149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUCA2 (Fucosidase alpha-L-2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (HRP)
MBS6378992-01 0.1 mL

FUCA2 (Fucosidase alpha-L-2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (HRP)

Sign In for Pricing
View Details
FUCA2 (Fucosidase alpha-L-2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (HRP)
MBS6378992-02 5x 0.1 mL

FUCA2 (Fucosidase alpha-L-2 Plasma, Alpha-L-fucoside Fucohydrolase 2, Alpha-L-fucosidase 2, dJ20N2.5, MGC1314, Plasma alpha-L-fucosidase, PSEC0151, RP1-20N2.5, UNQ227/PRO260) (HRP)

Sign In for Pricing
View Details
Corticotropin Releasing Factor Receptor 2 (CRHR2) (NM_001883) Human Over-expression Lysate
LS001395-100ug 100 µg

Corticotropin Releasing Factor Receptor 2 (CRHR2) (NM_001883) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Enolase (ENO)
MBS1330185-01 0.02 mg (E-Coli)

Recombinant Fasciola hepatica Enolase (ENO)

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Enolase (ENO)
MBS1330185-02 0.02 mg (Yeast)

Recombinant Fasciola hepatica Enolase (ENO)

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Enolase (ENO)
MBS1330185-03 0.1 mg (E-Coli)

Recombinant Fasciola hepatica Enolase (ENO)

Sign In for Pricing
View Details