Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS16 Rabbit Polyclonal Antibody (HRP)

MRPS16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COXPD2, RPMS16, CGI-132, MRP-S16

UniProt

Q9Y3D3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_057149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Eid1 shRNA (UAS) - Lentiviral mouse Eid1 shRNA (UAS, iRFP) (25)
GTR15152210 1 Vial

Lentiviral mouse Eid1 shRNA (UAS) - Lentiviral mouse Eid1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SPON2 antibody - N-terminal region
MBS3210739-01 0.1 mL

SPON2 antibody - N-terminal region

Sign In for Pricing
View Details
SPON2 antibody - N-terminal region
MBS3210739-02 5x 0.1 mL

SPON2 antibody - N-terminal region

Sign In for Pricing
View Details
LOC681383 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6454804 1.0 µg DNA

LOC681383 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Human IL-1R-2 protein (C-Fc)
CD01535-01 10 µg

Recombinant Human IL-1R-2 protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Human IL-1R-2 protein (C-Fc)
CD01535-02 50 µg

Recombinant Human IL-1R-2 protein (C-Fc)

Sign In for Pricing
View Details