Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB4 Rabbit Polyclonal Antibody (FITC)

NDUFB4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B15, CI-B15

UniProt

O95168

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDUFB4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSRB3 protein, Human, Recombinant (His)
E51P91235 20 µg

MSRB3 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
TRAT1 (T Cell Receptor Associated Transmembrane Adaptor 1, TRIM, TCRIM, HSPC062) (APC)
MBS6441644-01 0.1 mL

TRAT1 (T Cell Receptor Associated Transmembrane Adaptor 1, TRIM, TCRIM, HSPC062) (APC)

Sign In for Pricing
View Details
TRAT1 (T Cell Receptor Associated Transmembrane Adaptor 1, TRIM, TCRIM, HSPC062) (APC)
MBS6441644-02 5x 0.1 mL

TRAT1 (T Cell Receptor Associated Transmembrane Adaptor 1, TRIM, TCRIM, HSPC062) (APC)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Adhesion defective protein 3 (adn3), partial
MBS1221249 Inquire

Recombinant Schizosaccharomyces pombe Adhesion defective protein 3 (adn3), partial

Sign In for Pricing
View Details
TSC1 Recombinant Antibody, RBITC Conjugated
bsm-62173R-RBITC-01 20 µL

TSC1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
TSC1 Recombinant Antibody, RBITC Conjugated
bsm-62173R-RBITC-02 100 µL

TSC1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details