Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AG1 Rabbit Polyclonal Antibody (FITC)

OR2AG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR2AG3, OR11-79

UniProt

Q9H205

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2AG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCD Antibody
orb2809334 100 µL

PRKCD Antibody

Sign In for Pricing
View Details
Rat MCSF (Colony Stimulating Factor 1, Macrophage) ELISA Kit
EK242052 96 Well

Rat MCSF (Colony Stimulating Factor 1, Macrophage) ELISA Kit

Sign In for Pricing
View Details
Arid3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3723506 1.0 µg DNA

Arid3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SH3BP5 (SH3 Domain-binding Protein 5, SH3BP-5, SH3 Domain-binding Protein that Preferentially Associates with BTK, SAB) (AP) discontinued
133304-AP 100 µL

SH3BP5 (SH3 Domain-binding Protein 5, SH3BP-5, SH3 Domain-binding Protein that Preferentially Associates with BTK, SAB) (AP) discontinued

Sign In for Pricing
View Details
BPI Fold-Containing Family A Member 1 / PLUNC (BPIFA1) Peptide
abx616797 100 µg

BPI Fold-Containing Family A Member 1 / PLUNC (BPIFA1) Peptide

Sign In for Pricing
View Details
Anti-Amyloid Beta Antibody
F1918-50 50 mg

Anti-Amyloid Beta Antibody

Sign In for Pricing
View Details