Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AG1 Rabbit Polyclonal Antibody (HRP)

OR2AG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR2AG3, OR11-79

UniProt

Q9H205

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2AG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS10 Protein Lysate (Rat) with C-HA Tag
30519036 100 µg

MRPS10 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Hexamethylenetetramine (Hexamine) 99.0%
GPC8061-25Y 25 Kg

Hexamethylenetetramine (Hexamine) 99.0%

Sign In for Pricing
View Details
MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 750) discontinued
038322-ML750 100 µL

MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Multiplex Assay Kit for Secreted Phosphoprotein 2 (SPP2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031172 96 Tests

Multiplex Assay Kit for Secreted Phosphoprotein 2 (SPP2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
SIRT3 Adenovirus (Rat)
43808056 1.0 mL

SIRT3 Adenovirus (Rat)

Sign In for Pricing
View Details
LOC499602 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6266508 1.0 µg DNA

LOC499602 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details