Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAQR8 Rabbit Polyclonal Antibody (Biotin)

PAQR8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MPRB, LMPB1, C6orf33

UniProt

Q8TEZ7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAQR8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_588608

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA9 Mouse Monoclonal Antibody (BF647)
orb2369456 100 µL

CA9 Mouse Monoclonal Antibody (BF647)

Sign In for Pricing
View Details
M-CSF Recombinant Protein
orb1230496 0.01 mg

M-CSF Recombinant Protein

Sign In for Pricing
View Details
OR2W5 CRISPR Knock Out 293T Cell Line (Human)
35130141 1x 10^6 Cells / 1.0 mL

OR2W5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis CT_582 Protein (aa 1-255)
VAng-Lsx6586-50gEcoli 50 µg (E. coli)

Recombinant Chlamydophila Trachomatis CT_582 Protein (aa 1-255)

Sign In for Pricing
View Details
MAdCAM-1 (Mucosal Addressin Cell Adhesion Molecule 1) (Biotin)
M1275-03E-Biotin 100 µL

MAdCAM-1 (Mucosal Addressin Cell Adhesion Molecule 1) (Biotin)

Sign In for Pricing
View Details
Cytokeratin 16 (ABT-CK16) mouse mAb Ready to use
UB-GEN-16737 100 µL

Cytokeratin 16 (ABT-CK16) mouse mAb Ready to use

Sign In for Pricing
View Details