Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVR/CD155, Mouse (HEK293, His)

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration[1][2].

Product Specifications

Product Name Alternative

PVR/CD155 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd155-protein-mouse-hek293-his.html

Purity

95.0

Smiles

DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLHHHHHH

Molecular Formula

52118 (Gene_ID) Q8K094 (D29-L348) (Accession)

Molecular Weight

55-65 kDa

References & Citations

[1]Mandai K, et, al. Nectins and nectin-like molecules in development and disease. Curr Top Dev Biol. 2015;112:197-231.|[2]Ravens I, et, al. Characterization and identification of Tage4 as the murine orthologue of human poliovirus receptor/CD155. Biochem Biophys Res Commun. 2003 Dec 26;312 (4) :1364-71.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains)
MBS571857-01 1 mL

Goat anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains)

Ask
View Details
Goat anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains)
MBS571857-02 5x 1 mL

Goat anti Mouse IgG1 IgG2a IgG2b IgG3 (heavy and light chains)

Ask
View Details
Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, iRFP) plasmid
GTR15287656 1 Vial

Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, iRFP) plasmid

Ask
View Details
Avian Influenza Hemagglutinin 3 Antibody
MBS9404749-01 0.1 mL

Avian Influenza Hemagglutinin 3 Antibody

Ask
View Details
Avian Influenza Hemagglutinin 3 Antibody
MBS9404749-02 5x 0.1 mL

Avian Influenza Hemagglutinin 3 Antibody

Ask
View Details