Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP3 Rabbit Polyclonal Antibody (HRP)

REEP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Yip2b, C10orf74

UniProt

Q6NUK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human REEP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001001330

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF740 conjugate, 0.1mg/mL
BNC740705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human INS-IGF2 activation kit by CRISPRa
GA118882 1 Kit

Human INS-IGF2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ACLY Antibody
RC-4417-01 50 μL

Recombinant ACLY Antibody

Sign In for Pricing
View Details
Recombinant ACLY Antibody
RC-4417-02 100 µL

Recombinant ACLY Antibody

Sign In for Pricing
View Details
Recombinant ACLY Antibody
RC-4417-03 1 mL

Recombinant ACLY Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF594 conjugate, 0.1mg/mL
BNC942808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details