Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPAP1 Rabbit Polyclonal Antibody (HRP)

RPAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9BWH6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPAP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

144kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P16 ARC discontinued
505938-01 50 µL

P16 ARC discontinued

Sign In for Pricing
View Details
P16 ARC discontinued
505938-02 100 µL

P16 ARC discontinued

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (APC)
MBS6167508-01 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (APC)

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (APC)
MBS6167508-02 5x 0.1 mL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (APC)

Sign In for Pricing
View Details
Tumor Necrosis Factor alpha (Azide Free) (TNFa) discontinued
T9160-02GX 500 µg

Tumor Necrosis Factor alpha (Azide Free) (TNFa) discontinued

Sign In for Pricing
View Details
SUMF2 Rabbit Polyclonal Antibody
orb514173 100 µg

SUMF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details