Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP12 Rabbit Polyclonal Antibody (HRP)

RRP12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA0690

UniProt

Q5JTH9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055994

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sod3 3'UTR Lenti-reporter-Luc Vector
45105086 1.0 µg

Sod3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
KIF17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1148005 3x 1.0 µg

KIF17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na (+) -coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4) (Biotin)
138375-Biotin 100 µL

SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na (+) -coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4) (Biotin)

Sign In for Pricing
View Details
MSX1, ID (MSX1, HOX7, Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein) (APC) discontinued
038644-APC 200 µL

MSX1, ID (MSX1, HOX7, Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein) (APC) discontinued

Sign In for Pricing
View Details
FGA (N-term) Rabbit Polyclonal Antibody
E10G30418 100 µL

FGA (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRF5 Rabbit pAb
E45R22976N 50 ul

IRF5 Rabbit pAb

Sign In for Pricing
View Details