Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDAD1 Rabbit Polyclonal Antibody (FITC)

SDAD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9NVU7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SDAD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KTKTNPFSSSTNKEKKKQKNFMMMRYSQNVRSKNKRSFREKQLALRDALL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBE2Z activation kit by CRISPRa
GA112256 1 Kit

Human UBE2Z activation kit by CRISPRa

Sign In for Pricing
View Details
Two crank manual bed BHBD-509
BHBD-509 1 Unit

Two crank manual bed BHBD-509

Sign In for Pricing
View Details
Recombinant Human ABCG2 protein (His tag)
PDEH101078-01 20 µg

Recombinant Human ABCG2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ABCG2 protein (His tag)
PDEH101078-02 100 µg

Recombinant Human ABCG2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ABCG2 protein (His tag)
PDEH101078-03 500 µg

Recombinant Human ABCG2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ABCG2 protein (His tag)
PDEH101078-04 1 mg

Recombinant Human ABCG2 protein (His tag)

Sign In for Pricing
View Details