Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35D1 Rabbit Polyclonal Antibody (Biotin)

SLC35D1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SHNKND, UGTREL7

UniProt

B7Z3X2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC35D1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFM

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055954.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AmCyan (5F9) Monoclonal Antibody, PE-Cy5.5 Conjugated
bsm-33184M-PE-Cy5.5 100 µL

AmCyan (5F9) Monoclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
H-Trp-OBzl·HCl
5-03526 100 g

H-Trp-OBzl·HCl

Sign In for Pricing
View Details
ABCB9 Recombinant Protein (Mouse)
RP113327 100 µg

ABCB9 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit SOX2 antibody, clone SQab20200 (monoclonal)
orb2302812 100 µL

Rabbit SOX2 antibody, clone SQab20200 (monoclonal)

Sign In for Pricing
View Details
CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycoprotein, lhr, Ly 24, MC56, MDU2, MDU3, MGC10468, MIC4, MUTCH1, PGP1, Phagocytic Glycoprotein 1, Phagocytic Glycoprotein I) (MaxLight 550)
C2398-01Y-ML550 100 µL

CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycoprotein, lhr, Ly 24, MC56, MDU2, MDU3, MGC10468, MIC4, MUTCH1, PGP1, Phagocytic Glycoprotein 1, Phagocytic Glycoprotein I) (MaxLight 550)

Sign In for Pricing
View Details
Phospholipase C beta 2 Antibody, AbBy Fluor™ 555 Conjugated
bs-6472R-BF555-01 20 µL

Phospholipase C beta 2 Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details