Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Suclg2 Rabbit Polyclonal Antibody (HRP)

Suclg2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G-SCS, GTPSCS, AF171077, AW556404, D6Wsu120, D6Wsu120e, SCS-betaG

UniProt

Q9Z2I8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Suclg2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKGGVHLTKDPKVVGELAQQMIGYNLATKQTPKEGVKVNKVMVAEALDIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBP2 Antibody
OACA10150-100UG 100 µg

GBP2 Antibody

Sign In for Pricing
View Details
CLLD7 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2387879 100 µL

CLLD7 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Benzyl 2,6-diazaspiro[3.4]octane-6-carboxylate
OR312301 1 Each

Benzyl 2,6-diazaspiro[3.4]octane-6-carboxylate

Sign In for Pricing
View Details
CD31 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-10825R-BF647 100 µL

CD31 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 750)
MBS6256519-01 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 750)

Sign In for Pricing
View Details
CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 750)
MBS6256519-02 5x 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 750)

Sign In for Pricing
View Details