Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tns3 Rabbit Polyclonal Antibody (Biotin)

Tns3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ten, TEM6, Tens1, BC023928, F830010I22Rik

UniProt

Q5SSZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Tns3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (Biotin)
247197-Biotin 100 µL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (Biotin)

Sign In for Pricing
View Details
FGL2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2551127 100 µL

FGL2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Zfp36l1 Rat shRNA Plasmid (Locus ID 29344)
TR709976 1 Kit

Zfp36l1 Rat shRNA Plasmid (Locus ID 29344)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycine (Gly)
MBS2085403-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glycine (Gly)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycine (Gly)
MBS2085403-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glycine (Gly)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glycine (Gly)
MBS2085403-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Glycine (Gly)

Sign In for Pricing
View Details