Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tns3 Rabbit Polyclonal Antibody (FITC)

Tns3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ten, TEM6, Tens1, BC023928, F830010I22Rik

UniProt

Q5SSZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Tns3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK Antibody
F50188-0.4ML 0.4 mL

AMPK Antibody

Sign In for Pricing
View Details
Hba-a1 (NM_008218) Mouse Over-expression Lysate
LC700921 20 µg

Hba-a1 (NM_008218) Mouse Over-expression Lysate

Sign In for Pricing
View Details
IL-4R Recombinant Rabbit monoclonal Antibody
HA751378 100 µL

IL-4R Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD45 Mouse Monoclonal Antibody (2D1), APC Conjugate - Biotium Choice
P012-APC-125 1x 125 µL

CD45 Mouse Monoclonal Antibody (2D1), APC Conjugate - Biotium Choice

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A1]
TA505421AM 100 µL

GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A1]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Viscum album Lectin (Mistletoe) -VAA-, 1mL 5nm
GP-5401-5 1 mL

Colloidal Gold Conjugated Viscum album Lectin (Mistletoe) -VAA-, 1mL 5nm

Sign In for Pricing
View Details