Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XKR6 Rabbit Polyclonal Antibody (Biotin)

XKR6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

XRG6, C8orf5, C8orf7, C8orf21

UniProt

Q5GH73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LASYHKLLRDSRDDKKSMSYRGAIIQVFWRLFTISSRVISFALFASIFQL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCA2 (Probable Global Transcription Activator SNF2L2, ATP-dependent Helicase SMARCA2, BRG1-associated Factor 190B, BAF190B, Protein Brahma Homolog, hBRM, SNF2-alpha, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 2, BAF190B, BRM, SNF2A, SNF2L2, FLJ36757, MGC74511) (AP) discontinued
133550-AP 100 µL

SMARCA2 (Probable Global Transcription Activator SNF2L2, ATP-dependent Helicase SMARCA2, BRG1-associated Factor 190B, BAF190B, Protein Brahma Homolog, hBRM, SNF2-alpha, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 2, BAF190B, BRM, SNF2A, SNF2L2, FLJ36757, MGC74511) (AP) discontinued

Sign In for Pricing
View Details
KCNRG, CT (KCNRG, CLLD4, Potassium channel regulatory protein, Protein CLLD4) (MaxLight 550) discontinued
037347-ML550 100 µL

KCNRG, CT (KCNRG, CLLD4, Potassium channel regulatory protein, Protein CLLD4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lass6 3'UTR GFP Stable Cell Line
TU256955 1.0 mL

Lass6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PCGF5 Recombinant Rabbit mAb
BS47545-01 50 µL

PCGF5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PCGF5 Recombinant Rabbit mAb
BS47545-02 100 µL

PCGF5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mouse Vmn1r220 qPCR Primer Pair
QM52966S 200 Tests

Mouse Vmn1r220 qPCR Primer Pair

Sign In for Pricing
View Details