Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XKR6 Rabbit Polyclonal Antibody (HRP)

XKR6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

XRG6, C8orf5, C8orf7, C8orf21

UniProt

Q5GH73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LASYHKLLRDSRDDKKSMSYRGAIIQVFWRLFTISSRVISFALFASIFQL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Scg3 ELISA Kit
EF016151 96 Tests

Mouse Scg3 ELISA Kit

Sign In for Pricing
View Details
RGD1565498 sgRNA CRISPR Lentivector set (Rat)
K6037101 3x 1.0 µg

RGD1565498 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal FCRLB/FCRY Antibody (OTI5H6) [Biotin]
NBP2-72384B 0.1 mL

Mouse Monoclonal FCRLB/FCRY Antibody (OTI5H6) [Biotin]

Sign In for Pricing
View Details
CD5 (T-cell Surface Glycoprotein CD5, Lymphocyte Antigen T1/Leu-1, LEU1) (HRP)
C2255-85P-HRP 100 µL

CD5 (T-cell Surface Glycoprotein CD5, Lymphocyte Antigen T1/Leu-1, LEU1) (HRP)

Sign In for Pricing
View Details
CD44CR1-GFP (Puro) Lentiviral particles
LVP812-P 1x 10^8 IFU/mL - 200 μL

CD44CR1-GFP (Puro) Lentiviral particles

Sign In for Pricing
View Details
Gls Double Nickase Plasmid (m2)
sc-420586-NIC-2 20 µg

Gls Double Nickase Plasmid (m2)

Sign In for Pricing
View Details