Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIF1A Rabbit Polyclonal Antibody (HRP)

YIF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

54TM, YIF1, YIF1P, FinGER7

UniProt

O95070

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human YIF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065203

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Claudin 3/CLDN3 Antibody Picoband®, Cy3 Conjugate
A04393-5-Cy3 100 µg/Vial

Anti-Claudin 3/CLDN3 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Aniline, p- (5- (2-naphthyloxy) pentyloxy) -
orb1986517-01 25 mg

Aniline, p- (5- (2-naphthyloxy) pentyloxy) -

Sign In for Pricing
View Details
Aniline, p- (5- (2-naphthyloxy) pentyloxy) -
orb1986517-02 50 mg

Aniline, p- (5- (2-naphthyloxy) pentyloxy) -

Sign In for Pricing
View Details
Aniline, p- (5- (2-naphthyloxy) pentyloxy) -
orb1986517-03 100 mg

Aniline, p- (5- (2-naphthyloxy) pentyloxy) -

Sign In for Pricing
View Details
TRIM39, ID (TRIM39, RNF23, TFP, E3 ubiquitin-protein ligase TRIM39, RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39) (MaxLight 550) discontinued
043237-ML550 100 µL

TRIM39, ID (TRIM39, RNF23, TFP, E3 ubiquitin-protein ligase TRIM39, RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39) (MaxLight 550) discontinued

Sign In for Pricing
View Details
[2- (2,4-Difluorophenyl) ethyl] (methyl) amine hydrochloride
RPD12869-01 50 mg

[2- (2,4-Difluorophenyl) ethyl] (methyl) amine hydrochloride

Sign In for Pricing
View Details