Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACYP1 Rabbit Polyclonal Antibody (FITC)

ACYP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACYPE

UniProt

P07311

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ACYP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001098

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p27 KIP 1 Polyclonal Antibody
MBS9457703-01 0.05 mL

p27 KIP 1 Polyclonal Antibody

Sign In for Pricing
View Details
p27 KIP 1 Polyclonal Antibody
MBS9457703-02 0.1 mL

p27 KIP 1 Polyclonal Antibody

Sign In for Pricing
View Details
p27 KIP 1 Polyclonal Antibody
MBS9457703-03 5x 0.1 mL

p27 KIP 1 Polyclonal Antibody

Sign In for Pricing
View Details
HCV core recombinant antigen a.a 2 to a.a 192 of HCV polyprotein 22 kDa
00115-V-01 100 µg/Vial

HCV core recombinant antigen a.a 2 to a.a 192 of HCV polyprotein 22 kDa

Sign In for Pricing
View Details
HCV core recombinant antigen a.a 2 to a.a 192 of HCV polyprotein 22 kDa
00115-V-02 1 mg

HCV core recombinant antigen a.a 2 to a.a 192 of HCV polyprotein 22 kDa

Sign In for Pricing
View Details
Human LAIR1 (NM_002287) AAV Particle
RC206439A1V 250 µL

Human LAIR1 (NM_002287) AAV Particle

Sign In for Pricing
View Details