Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAP, Human (His)

PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PAP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pap-protein-human-his.html

Purity

95.0

Smiles

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

Molecular Formula

11333 (Gene_ID) Q13442 (M1-K181) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAGLU Blocking Peptide
MBS9632323-01 1 mg

NAGLU Blocking Peptide

Sign In for Pricing
View Details
NAGLU Blocking Peptide
MBS9632323-02 5x 1 mg

NAGLU Blocking Peptide

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Human IgG (H+L) Secondary Antibody [DyLight 488]
NB7483G 0.5 mL

Goat Polyclonal Goat anti-Human IgG (H+L) Secondary Antibody [DyLight 488]

Sign In for Pricing
View Details
8-Hydroxy-2(1H)-quinolinone
TRC-H953185-250MG 250 mg

8-Hydroxy-2(1H)-quinolinone

Sign In for Pricing
View Details
Bovine Serum Albumin (BSA), Precision Grade Fatty Acid Free (NZ)
A-425-10-10g 10 g

Bovine Serum Albumin (BSA), Precision Grade Fatty Acid Free (NZ)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Kynurenine formamidase (kynB)
MBS1010736-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei Kynurenine formamidase (kynB)

Sign In for Pricing
View Details