Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARSJ Rabbit Polyclonal Antibody (HRP)

ARSJ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASJ

UniProt

Q5FYB0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARSJ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VWGPWYKEETKKKKPSKNQAEKKQKKSKKKKKKQQKAVSGSTCHSGVTCG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_078866

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: OTI5B11]
CF812512 100 µg

Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: OTI5B11]

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), Biotin conjugate, 0.1mg/mL
BNCB3256-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GF-1 Blood Total RNA Extraction Kit (Proteinase K & DNase I included), 25 preps
GF-TB-025 25 Preparations

GF-1 Blood Total RNA Extraction Kit (Proteinase K & DNase I included), 25 preps

Sign In for Pricing
View Details
Gelsolin Recombinant Rabbit Monoclonal Antibody [JB36-68]
ET7107-45 100 µL

Gelsolin Recombinant Rabbit Monoclonal Antibody [JB36-68]

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF640R conjugate, 0.1mg/mL
BNC401602-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rem2 Mouse Monoclonal Antibody [B4-D6]
M1403-1 100 µL

Rem2 Mouse Monoclonal Antibody [B4-D6]

Sign In for Pricing
View Details