Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPLKIP Rabbit Polyclonal Antibody (Biotin)

MPLKIP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ABHS, TTD4, ORF20, C7orf11

UniProt

Q8TAP9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MPLKIP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_619646

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)
MBS6240015-01 0.1 mL

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)

Sign In for Pricing
View Details
POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)
MBS6240015-02 5x 0.1 mL

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral mouse Sdr42e1 shRNA (UAS) - Lentiviral mouse Sdr42e1 shRNA (UAS, GFP) plasmid
GTR15273034 1 Vial

Lentiviral mouse Sdr42e1 shRNA (UAS) - Lentiviral mouse Sdr42e1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
TAAR2 Protein Vector (Human) (pPB-N-His)
PV134459 500 ng

TAAR2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TRIM21/SS-A/SS Rabbit Polyclonal Antibody (Fluoro550)
orb3111743 100 µg

TRIM21/SS-A/SS Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
SLC25A31 Antibody
orb2627180 100 µL

SLC25A31 Antibody

Sign In for Pricing
View Details