Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN2 Rabbit Polyclonal Antibody (HRP)

CAPRIN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EEG1, EEG-1, C1QDC1, RNG140

UniProt

Q6IMN6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAPRIN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

124kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Olfactory receptor 13C2 (OR13C2) ELISA Kit
GTR10323230 96 Well

Porcine Olfactory receptor 13C2 (OR13C2) ELISA Kit

Sign In for Pricing
View Details
Megestrol Acetate-d3 (17- (Acetyloxy) -6-methyl-d3-pregna-4,6-diene-3,20-dione, BDH 1298-d3, DMAP-d3, MGA-d3, Magestin-d3, Maygace-d3, Megace-d3, Megeron-d3, Megestat-d3, Magestryl Acetate-d3, Ovarid-d3)
M2860-55M 500 µg

Megestrol Acetate-d3 (17- (Acetyloxy) -6-methyl-d3-pregna-4,6-diene-3,20-dione, BDH 1298-d3, DMAP-d3, MGA-d3, Magestin-d3, Maygace-d3, Megace-d3, Megeron-d3, Megestat-d3, Magestryl Acetate-d3, Ovarid-d3)

Sign In for Pricing
View Details
Phospho-NT5C (Ser184) Antibody
AF7422-01 100 µL

Phospho-NT5C (Ser184) Antibody

Sign In for Pricing
View Details
Phospho-NT5C (Ser184) Antibody
AF7422-02 200 µL

Phospho-NT5C (Ser184) Antibody

Sign In for Pricing
View Details
Arl11 (NM_001013433) Rat Tagged Lenti ORF Clone
RR209343L4 10 µg

Arl11 (NM_001013433) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Xantphos Pd G3
TRC-X144580-50MG 50 mg

Xantphos Pd G3

Sign In for Pricing
View Details