Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPRIN2 Rabbit Polyclonal Antibody (HRP)

CAPRIN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EEG1, EEG-1, C1QDC1, RNG140

UniProt

Q6IMN6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPRIN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p60 CAF1 (CHAF1B) (NM_005441) Human Recombinant Protein
TP302858M 100 µg

p60 CAF1 (CHAF1B) (NM_005441) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal BP1 Antibody (OTI8A1) [Biotin]
NBP2-70581B 0.1 mL

Mouse Monoclonal BP1 Antibody (OTI8A1) [Biotin]

Sign In for Pricing
View Details
Mouse CCN2 ELISA Kit
E101832 1 Each

Mouse CCN2 ELISA Kit

Sign In for Pricing
View Details
LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (MaxLight 550)
248168-ML550 100 µL

LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (MaxLight 550)

Sign In for Pricing
View Details
2-Chloro-n, n-diphenylacetamide
OR1001923-01 5 g

2-Chloro-n, n-diphenylacetamide

Sign In for Pricing
View Details
2-Chloro-n, n-diphenylacetamide
OR1001923-02 10 g

2-Chloro-n, n-diphenylacetamide

Sign In for Pricing
View Details