Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC3A Rabbit Polyclonal Antibody (HRP)

CLEC3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLECSF1

UniProt

O75596

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPINT1/HAI-1 PicoKine ELISA Kit
MBS178520-01 96 Well

Human SPINT1/HAI-1 PicoKine ELISA Kit

Sign In for Pricing
View Details
Human SPINT1/HAI-1 PicoKine ELISA Kit
MBS178520-02 5x 96 Well

Human SPINT1/HAI-1 PicoKine ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Alpha (PKCa) ELISA Kit
EKN48025-01 48 Tests

Human Protein Kinase C Alpha (PKCa) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Alpha (PKCa) ELISA Kit
EKN48025-02 96 Tests

Human Protein Kinase C Alpha (PKCa) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Alpha (PKCa) ELISA Kit
EKN48025-03 5x 96 Tests

Human Protein Kinase C Alpha (PKCa) ELISA Kit

Sign In for Pricing
View Details
Mylk4 3'UTR GFP Stable Cell Line
TU163726 1.0 mL

Mylk4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details