Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC8 Rabbit Polyclonal Antibody (Biotin)

DNAJC8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPF31, HSPC331

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit
MBS7222388-01 48 Well

Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit

Sign In for Pricing
View Details
Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit
MBS7222388-02 96 Well

Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit

Sign In for Pricing
View Details
Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit
MBS7222388-03 5x 96 Well

Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit

Sign In for Pricing
View Details
Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit
MBS7222388-04 10x 96 Well

Goat Cdc42 effector protein 1 (CDC42EP1) ELISA Kit

Sign In for Pricing
View Details
Zfp787 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4923807 1.0 µg DNA

Zfp787 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Hsa-miR-3200-5p agomir
HY-R00668A-01 5 nmol

Hsa-miR-3200-5p agomir

Sign In for Pricing
View Details