Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP9 Rabbit Polyclonal Antibody (Biotin)

FKBP9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FKBP60, FKBP63, PPIase

UniProt

O95302

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FKBP9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VASGKGKLAPGFDAELIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myocilin (MYOC) Human Gene Knockout Kit (CRISPR)
KN206556RB 1 Kit

Myocilin (MYOC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-Keto Cholesterol-d7
TRC-K185052-1MG 1 mg

7-Keto Cholesterol-d7

Sign In for Pricing
View Details
S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Over-expression Lysate
LC422620 20 µg

S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific,
AAF-532-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific,

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Recombinant Protein
TP313132L 1 mg

HSD17B13 (NM_178135) Human Recombinant Protein

Sign In for Pricing
View Details
Tmem203 Mouse Gene Knockout Kit (CRISPR)
KN517792 1 Kit

Tmem203 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details