Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gprc5d Rabbit Polyclonal Antibody (HRP)

Gprc5d Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9JIL6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gprc5d

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001192325

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pleckstrin (FLJ27168, P47, Platelet and Leukocyte C Kinase Substrate, Platelet P47, Platelet p47 Protein, PLEK, Platelet 47kD Protein) (PE)
MBS6159515-01 0.1 mL

Pleckstrin (FLJ27168, P47, Platelet and Leukocyte C Kinase Substrate, Platelet P47, Platelet p47 Protein, PLEK, Platelet 47kD Protein) (PE)

Sign In for Pricing
View Details
Pleckstrin (FLJ27168, P47, Platelet and Leukocyte C Kinase Substrate, Platelet P47, Platelet p47 Protein, PLEK, Platelet 47kD Protein) (PE)
MBS6159515-02 5x 0.1 mL

Pleckstrin (FLJ27168, P47, Platelet and Leukocyte C Kinase Substrate, Platelet P47, Platelet p47 Protein, PLEK, Platelet 47kD Protein) (PE)

Sign In for Pricing
View Details
CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (Azide free) (HRP)
MBS6469278-01 0.2 mL

CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (Azide free) (HRP)

Sign In for Pricing
View Details
CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (Azide free) (HRP)
MBS6469278-02 5x 0.2 mL

CLDN2, NT (Claudin-2, SP82, PSEC0059, SP82, UNQ705/PRO1356) (Azide free) (HRP)

Sign In for Pricing
View Details
Parisyunnanoside B
HY-N8814 1 Each

Parisyunnanoside B

Sign In for Pricing
View Details
FLJ25770 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV810880 1.0 µg DNA

FLJ25770 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details