Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC2 Rabbit Polyclonal Antibody (Biotin)

KDELC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KDELC2

UniProt

Q7Z4H8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human KDELC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_714916

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human UBE2R2 Protein, His, E.coli-10ug
QP13867-10ug 10ug

Recombinant Human UBE2R2 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
TM111, NT (EMC3, TMEM111, ER membrane protein complex subunit 3, Transmembrane protein 111) (MaxLight 750)
MBS6355963-01 0.1 mL

TM111, NT (EMC3, TMEM111, ER membrane protein complex subunit 3, Transmembrane protein 111) (MaxLight 750)

Sign In for Pricing
View Details
TM111, NT (EMC3, TMEM111, ER membrane protein complex subunit 3, Transmembrane protein 111) (MaxLight 750)
MBS6355963-02 5x 0.1 mL

TM111, NT (EMC3, TMEM111, ER membrane protein complex subunit 3, Transmembrane protein 111) (MaxLight 750)

Sign In for Pricing
View Details
Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit
MBS074763-01 48 Strip Well

Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit

Sign In for Pricing
View Details
Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit
MBS074763-02 96 Strip Well

Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit

Sign In for Pricing
View Details
Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit
MBS074763-03 5x 96 Strip Well

Porcine Transient Receptor Potential Cation Channel Subfamily C, Member 6 ELISA Kit

Sign In for Pricing
View Details