Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF24 Rabbit Polyclonal Antibody (Biotin)

KIF24 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C9orf48, bA571F15.4

UniProt

Q5T7B8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF24

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRRGEINIITVEDKETLLV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

140kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_919289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit
MBS7213093-01 48 Well

Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit
MBS7213093-02 96 Well

Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit
MBS7213093-03 5x 96 Well

Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit

Sign In for Pricing
View Details
Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit
MBS7213093-04 10x 96 Well

Rat Alpha 2B adrenergic receptor (ADRA2B) ELISA Kit

Sign In for Pricing
View Details
TCTN2 Polyclonal Antibody
ANT-14672-50ug 50 µg

TCTN2 Polyclonal Antibody

Sign In for Pricing
View Details
Parathyroid hormone related protein (PTHLH) Human Over-expression Lysate
orb1375566 20 µg

Parathyroid hormone related protein (PTHLH) Human Over-expression Lysate

Sign In for Pricing
View Details