Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6G5C Rabbit Polyclonal Antibody (FITC)

LY6G5C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G5C, NG33, C6orf20, LY6G5CA, LY6G5CB

UniProt

Q5SRR4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LY6G5C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B (4C4.9), CF647 conjugate, 0.1mg/mL
BNC470143-100 1x 100 µL

S100B (4C4.9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF488A conjugate, 0.1mg/mL
BNC882176-500 1x 500 µL

MMP9 (rMMP9/1769), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Electric Wheelchair BHBD-911
BHBD-911 1 Unit

Electric Wheelchair BHBD-911

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF740 conjugate, 0.1mg/mL
BNC743006-100 1x 100 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF405S conjugate, 0.1mg/mL
BNC042341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2505), 0.2mg/mL
BNUB2505-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2505), 0.2mg/mL

Sign In for Pricing
View Details