Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL36 Rabbit Polyclonal Antibody (HRP)

MRPL36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RPMJ, BRIP1, L36mt, PRPL36, MRP-L36

UniProt

Q9P0J6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPM2 siRNA (Human)
MBS8237367-01 15 nmol

NPM2 siRNA (Human)

Sign In for Pricing
View Details
NPM2 siRNA (Human)
MBS8237367-02 30 nmol

NPM2 siRNA (Human)

Sign In for Pricing
View Details
NPM2 siRNA (Human)
MBS8237367-03 5x 30 nmol

NPM2 siRNA (Human)

Sign In for Pricing
View Details
Reptin, CT (RuvB-like 2, 48kD TATA Box-binding Protein-interacting Protein, 48kD TBP-Interacting Protein, TIP49b, Repressing Pontin 52, Reptin 52, 51kD Erythrocyte Cytosolic Protein, ECP-51, TIP60-associated Protein 54-beta, TAP54-beta, TIP48, TIP49B, RUVBL2, INO80J, CGI-46) (Azide free) (HRP) discontinued
R9931-16A-HRP 200 µL

Reptin, CT (RuvB-like 2, 48kD TATA Box-binding Protein-interacting Protein, 48kD TBP-Interacting Protein, TIP49b, Repressing Pontin 52, Reptin 52, 51kD Erythrocyte Cytosolic Protein, ECP-51, TIP60-associated Protein 54-beta, TAP54-beta, TIP48, TIP49B, RUVBL2, INO80J, CGI-46) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Guinea pig lyso-platelet activating factor (lyso-PAF) ELISA Kit
MBS2605890-01 48 Well

Guinea pig lyso-platelet activating factor (lyso-PAF) ELISA Kit

Sign In for Pricing
View Details
Guinea pig lyso-platelet activating factor (lyso-PAF) ELISA Kit
MBS2605890-02 96 Well

Guinea pig lyso-platelet activating factor (lyso-PAF) ELISA Kit

Sign In for Pricing
View Details