Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSGN1 Rabbit Polyclonal Antibody (FITC)

MSGN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSOG, pMsgn1

UniProt

A6NI15

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MSGN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099039

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS27AP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV784674 1.0 µg DNA

RPS27AP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 650)
MBS6399093-01 0.1 mL

ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 650)

Sign In for Pricing
View Details
ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 650)
MBS6399093-02 5x 0.1 mL

ZNF232 (Zinc Finger Protein 232, Zinc Finger and SCAN Domain-containing Protein 11, ZSCAN11) (MaxLight 650)

Sign In for Pricing
View Details
UPK2 Polyclonal Antibody
MBS9431380-01 0.05 mL

UPK2 Polyclonal Antibody

Sign In for Pricing
View Details
UPK2 Polyclonal Antibody
MBS9431380-02 0.1 mL

UPK2 Polyclonal Antibody

Sign In for Pricing
View Details
UPK2 Polyclonal Antibody
MBS9431380-03 5x 0.1 mL

UPK2 Polyclonal Antibody

Sign In for Pricing
View Details