Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Product Specifications

Abbreviation

Recombinant Human TNFSF8 protein, partial (Active)

Gene Name

TNFSF8

UniProt

P32971

Expression Region

63-234aa

Organism

Homo sapiens (Human)

Target Sequence

QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Tag

N-terminal hFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CD30 (CSB-MP023983HU1) at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit
MBS9391919-01 48 Well

Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit

Sign In for Pricing
View Details
Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit
MBS9391919-02 96 Well

Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit

Sign In for Pricing
View Details
Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit
MBS9391919-03 5x 96 Well

Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit

Sign In for Pricing
View Details
Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit
MBS9391919-04 10x 96 Well

Rat NACHT, LRR and PYD Domains-Containing Protein 10 (NLRP10) ELISA Kit

Sign In for Pricing
View Details
CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle
RC225528L2V 200 µL

CCRL2 (NM_001130910) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Smad4 (DCS-46)
sc-73599 200 µg/mL

Smad4 (DCS-46)

Sign In for Pricing
View Details