Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naaladl2 Rabbit Polyclonal Antibody (Biotin)

Naaladl2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gm1021, EG635702, 2810043G22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_915927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO1 (NM_001038633) Human Over-expression Lysate
LC422005 20 µg

RSPO1 (NM_001038633) Human Over-expression Lysate

Sign In for Pricing
View Details
PSME2 Antibody
KC-30483-01 50 μL

PSME2 Antibody

Sign In for Pricing
View Details
PSME2 Antibody
KC-30483-02 100 µL

PSME2 Antibody

Sign In for Pricing
View Details
PSME2 Antibody
KC-30483-03 1 mL

PSME2 Antibody

Sign In for Pricing
View Details
Ferritin Labeled Lectin Kit #2
ILK-002 1 mg

Ferritin Labeled Lectin Kit #2

Sign In for Pricing
View Details
PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]
TA502811AM 100 µL

PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details