Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gm1021, EG635702, 2810043G22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_915927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TMEM43 Antibody
RC-5418-01 50 μL

Recombinant TMEM43 Antibody

Sign In for Pricing
View Details
Recombinant TMEM43 Antibody
RC-5418-02 100 µL

Recombinant TMEM43 Antibody

Sign In for Pricing
View Details
Recombinant TMEM43 Antibody
RC-5418-03 1 mL

Recombinant TMEM43 Antibody

Sign In for Pricing
View Details
p38 (CRK) Human Knockdown Lysate
LY300123 100 µg

p38 (CRK) Human Knockdown Lysate

Sign In for Pricing
View Details
NF-KB p105 Antibody
KC-18067-01 50 μL

NF-KB p105 Antibody

Sign In for Pricing
View Details
NF-KB p105 Antibody
KC-18067-02 100 µL

NF-KB p105 Antibody

Sign In for Pricing
View Details