Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Naaladl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gm1021, EG635702, 2810043G22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_915927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin beta III (SPTBN2) (SPTBN2/1778), 0.2mg/mL
BNUB1778-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), 0.2mg/mL

Sign In for Pricing
View Details
Human FA2H activation kit by CRISPRa
GA112387 1 Kit

Human FA2H activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF647 conjugate, 0.1mg/mL
BNC472175-500 1x 500 µL

Cytokeratin 8 (KRT8) (rB22.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EPB42 Rabbit Polyclonal Antibody
AP54921SU-N 200 µL

EPB42 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Octanoylamide Propylbetaine
TRC-O238015-250MG 250 mg

Octanoylamide Propylbetaine

Sign In for Pricing
View Details
DPH2 (NM_001384) Human Over-expression Lysate
LC419990 20 µg

DPH2 (NM_001384) Human Over-expression Lysate

Sign In for Pricing
View Details