Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naaladl2 Rabbit Polyclonal Antibody (HRP)

Naaladl2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm1021, EG635702, 2810043G22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_915927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal DLL4 Antibody (004) [DyLight 550]
NBP2-90662R 0.1 mL

Rabbit Monoclonal DLL4 Antibody (004) [DyLight 550]

Sign In for Pricing
View Details
WDR43 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2632205 3x 1.0 µg

WDR43 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
2- (3-Aminopropoxy) ethanol
OR1043286-01 100 mg

2- (3-Aminopropoxy) ethanol

Sign In for Pricing
View Details
2- (3-Aminopropoxy) ethanol
OR1043286-02 250 mg

2- (3-Aminopropoxy) ethanol

Sign In for Pricing
View Details
2- (3-Aminopropoxy) ethanol
OR1043286-03 1 g

2- (3-Aminopropoxy) ethanol

Sign In for Pricing
View Details
2- (3-Aminopropoxy) ethanol
OR1043286-04 5 g

2- (3-Aminopropoxy) ethanol

Sign In for Pricing
View Details