Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naaladl2 Rabbit Polyclonal Antibody (HRP)

Naaladl2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm1021, EG635702, 2810043G22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_915927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ub (Acetyl Lys27) Polyclonal Antibody
UB-GEN-2274 100 µL

Ub (Acetyl Lys27) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-KEAP1 antibody
SL4900R-01 50 µL

Rabbit Anti-KEAP1 antibody

Sign In for Pricing
View Details
Rabbit Anti-KEAP1 antibody
SL4900R-02 100 µL

Rabbit Anti-KEAP1 antibody

Sign In for Pricing
View Details
Recombinant Human MMUT Protein
E30P01874A 50 µg

Recombinant Human MMUT Protein

Sign In for Pricing
View Details
TNFRSF10D Rabbit Monoclonal Antibody
E49Y8417 100 µL

TNFRSF10D Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human NMRK2 qPCR Primer Pair
QH38589S 200 Tests

Human NMRK2 qPCR Primer Pair

Sign In for Pricing
View Details