Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7D4 Rabbit Polyclonal Antibody (HRP)

OR7D4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR19B, hg105, OR19-7, OR19-B, OR7D4P

UniProt

Q8NG98

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7D4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGALERLLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse urease related protein C (UreC) ELISA Kit
MBS262601-01 48 Well

Mouse urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details
Mouse urease related protein C (UreC) ELISA Kit
MBS262601-02 96 Well

Mouse urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details
Mouse urease related protein C (UreC) ELISA Kit
MBS262601-03 5x 96 Well

Mouse urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details
Mouse urease related protein C (UreC) ELISA Kit
MBS262601-04 10x 96 Well

Mouse urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details
Advanced Plus Mechanical Pipette
21011320 1 PC

Advanced Plus Mechanical Pipette

Sign In for Pricing
View Details
Rabbit ADP-ribosyl cyclase 2 (BST1) ELISA Kit
MBS7248308-01 48 Well

Rabbit ADP-ribosyl cyclase 2 (BST1) ELISA Kit

Sign In for Pricing
View Details