Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7D4 Rabbit Polyclonal Antibody (HRP)

OR7D4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OR19B, hg105, OR19-7, OR19-B, OR7D4P

UniProt

Q8NG98

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR7D4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGALERLLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001005191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 750 Anti-human CD58 Antibody *HI58a*
105800L0-AAT 100 Tests

IFluor® 750 Anti-human CD58 Antibody *HI58a*

Sign In for Pricing
View Details
AMPK alpha 1 Recombinant Rabbit mAb, BF405 conjugated
orb3184136 100 µL

AMPK alpha 1 Recombinant Rabbit mAb, BF405 conjugated

Sign In for Pricing
View Details
BRAF inhibitor
A3263-10 10 mg

BRAF inhibitor

Sign In for Pricing
View Details
Metastin (45-54)
sc-221883 1 mg

Metastin (45-54)

Sign In for Pricing
View Details
Anti-GALP Antibody Picoband®, Carrier-free
A04786-1-carrier-free 100 µg/Vial

Anti-GALP Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Lentiviral human SURF4 shRNA (UAS) - Lentiviral human SURF4 shRNA (UAS, iRFP) plasmid
GTR15336871 1 Vial

Lentiviral human SURF4 shRNA (UAS) - Lentiviral human SURF4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details