Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr872 Rabbit Polyclonal Antibody (HRP)

Olfr872 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MOR145, MOR145-3

UniProt

Q8VFI9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Olfr872

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIPTKDGKYKAFSTCGSHLSVVCLFYGTSIGVYIGSTASNSPKNCAIASL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_666771

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e Mouse Monoclonal Antibody (SK7), CF®660C Conjugate - Biotium Choice
P002-660C-125 1x 125 µL

CD3e Mouse Monoclonal Antibody (SK7), CF®660C Conjugate - Biotium Choice

Sign In for Pricing
View Details
T (NM_003181) Human Over-expression Lysate
LY401103 100 µg

T (NM_003181) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS504721 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/3772R), CF740 conjugate, 0.1mg/mL
BNC743772-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/3772R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRP94 Antibody: HRP
SPC-101D-HRP 100 µg

GRP94 Antibody: HRP

Sign In for Pricing
View Details
ZFX (NM_001178086) Human Over-expression Lysate
LC433300 20 µg

ZFX (NM_001178086) Human Over-expression Lysate

Sign In for Pricing
View Details