Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P4HA3 Rabbit Polyclonal Antibody (HRP)

P4HA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q7Z4N8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human P4HA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_878907

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Bovine Thrombospondin-2 (THBS2) ELISA Kit
GR112353 96 Well

Nori® Bovine Thrombospondin-2 (THBS2) ELISA Kit

Sign In for Pricing
View Details
Norethisterone EP Impurity F
RM-N152706-01 10 mg

Norethisterone EP Impurity F

Sign In for Pricing
View Details
Norethisterone EP Impurity F
RM-N152706-02 25 mg

Norethisterone EP Impurity F

Sign In for Pricing
View Details
Norethisterone EP Impurity F
RM-N152706-03 50 mg

Norethisterone EP Impurity F

Sign In for Pricing
View Details
Norethisterone EP Impurity F
RM-N152706-04 100 mg

Norethisterone EP Impurity F

Sign In for Pricing
View Details
Guinea pig Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit
MBS2602163-01 48 Well

Guinea pig Proteinase 3-antineutrophil cytoplasmic antibody-(C-ANCA/PR3 IgG) ELISA Kit

Sign In for Pricing
View Details